ELISA Recombinant Arabidopsis thaliana Defender against cell death 2(DAD2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:O22622 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVKSTSKDAQDLFHSLHSAYTATPTNLKIIDLYVCFAVFTALIQVAYMALVGSFPFNSFL SGVLSCIGTAVLAVCLRIQVNKENKEFKDLAPERAFADFVLCNLVLHLVIINFLG Protein Names:Recommended name: Defender against cell death 2 Short name= AtDAD2 Short name= DAD-2 Gene Names:Name:DAD2 Ordered Locus Names:At2g35520 ORF Names:T32F12.10 Expression Region:1-115 Sequence Info:fµLl length protein