ELISA Recombinant Arabidopsis thaliana Defender against cell death 2(DAD2)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:O22622
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVKSTSKDAQDLFHSLHSAYTATPTNLKIIDLYVCFAVFTALIQVAYMALVGSFPFNSFL SGVLSCIGTAVLAVCLRIQVNKENKEFKDLAPERAFADFVLCNLVLHLVIINFLG
Protein Names:Recommended name: Defender against cell death 2 Short name= AtDAD2 Short name= DAD-2
Gene Names:Name:DAD2 Ordered Locus Names:At2g35520 ORF Names:T32F12.10
Expression Region:1-115
Sequence Info:fµLl length protein