Se rendre au contenu

ELISA Recombinant Macrophage migration inhibitory factor(MIF) (Active)

https://www.keyrusbiopharma.com/web/image/product.template/134962/image_1920?unique=706639d
Quantity:100µg. Research Areas:Cancer Uniprot NO.:P14174 Uniprot Entry Name: Gene Names:MIF Species:Homo sapiens () Source:Mammalian cell Expression Region:2-115aa Sequence:PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA Protein Description:FµLl Length of Mature Protein Tag Info:C-terminal hFc-tagged Mol. Weight:41.3 kDa Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized MIF at 2 ?g/mL can bind Anti- MIF Rabbit Monoclonal Antibody?CSB-RA146975A0HU?, the EC50 is 49.61-69.45 ng/mL. Purity:Greater than 90% as determined by SDS-PAGE. Endotoxin:Less than 1.0 EU/µg as determined by LAL method. Form:Lyophilized powder Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4 Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Alternative Name/ Alias:(MIF)(Glycosylation-inhibiting factor)(GIF)(L-dopachrome isomerase)(L-dopachrome tautomerase)(Phenylpyruvate tautomerase) Relevance:Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation sµggests a role as mediator in regµLating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity. PubMed ID: Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link:

520,00 € 520.0 EUR 520,00 €

520,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables