ELISA Recombinant Enterobacteria phage lambda Protein rexB(rexB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Enterobacteria phage lambda (Bacteriophage lambda) Uniprot NO.:P03759 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRNRIMPGVYIVIIPYVIVSICYLLFRHYIPGVSFSAHRDGLGATLSSYAGTMIAILIAA LTFLIGSRTRRLAKIREYGYMTSVVIVYALSFVELGALFFCGLLLLSSISGYMIPTIAIG IASASFIHICILVFQLYNLTREQE Protein Names:Recommended name: Protein rexB Gene Names:Name:rexB Expression Region:1-144 Sequence Info:fµLl length protein