Skip to Content

ELISA Recombinant Lymphocyte antigen 6 complex locus protein G6d(LY6G6D),partial

https://www.keyrusbiopharma.com/web/image/product.template/134888/image_1920?unique=706639d
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20171018 Research areas: Signal Transduction Target / Protein: LY6G6D Biologically active: Not Tested Expression system: E.coli Species of origin: Homo sapiens () Delivery time: 3-7 business days Uniprot ID: O95868 AA Sequence: LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS Tag info: N-terminal 10xHis-B2M-JD-tagged Expression Region: 10-104aa Protein length: Partial MW: 15.5 kDa Alternative Name(s): Megakaryocyte-enhanced gene transcript 1 protein Relevance: 0 Reference: "Genes encoding three new members of the leukocyte antigen 6 superfamily and a novel member of Ig superfamily, together with genes encoding the regµLatory nuclear chloride ion channel protein (hRNCC) and an N omega-N omega-dimethylarginine dimethylaminohydrolase homologue, are found in a 30-kb segment of the MHC class III region." Ribas G., Neville M., Wixon J.L., Cheng J., Campbell R.D. J. Immunol. 163:278-287(1999) Purity: Greater than 85% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

709.00 € 709.0 EUR 709.00 €

709.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days