Se rendre au contenu

ELISA Recombinant Selenoprotein M(SELM)

https://www.keyrusbiopharma.com/web/image/product.template/138627/image_1920?unique=18ea82b
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: Q8WWX9 Gene Names: SELM Organism: Homo sapiens () AA Sequence: ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL Expression Region: 24-145aa Sequence Info: FµLl Length of Mature Protein Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 17.9 kDa Alternative Name(s): Relevance: May function as a thiol-disµLfide oxidoreductase that participates in disµLfide bond formation. Reference: "The status, quality, and expansion of the NIH fµLl-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

709,00 € 709.0 EUR 709,00 €

709,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables