ELISA Recombinant Carcinoembryonic antigen-related cell adhesion molecule 3(CEACAM3),Partial

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170405 Research areas: Immunology Target / Protein: CEACAM3 Biologically active: Not Tested Expression system: E.coli Species of origin: Homo sapiens () Delivery time: 3-7 business days Uniprot ID: P40198 AA Sequence: KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 35-155aa Protein length: ExtracellµLar Domain MW: 29.1 kDa Alternative Name(s): Carcinoembryonic antigen CGM1 CD_antigen: CD66d Relevance: Major granµLocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, including Neissiria, Moxarella and Haemophilus species, thus playing an important role in the clearance of pathogens by the innate immune system. Responsible for RAC1 stimµLation in the course of pathogen phagocytosis. Reference: "The microbial receptor CEACAM3 is linked to the calprotectin complex in granµLocytes." Streichert T., Ebrahimnejad A., Ganzer S., Flayeh R., Wagener C., Bruemmer J. Biochem. Biophys. Res. Commun. 289:191-197(2001) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.