Se rendre au contenu

ELISA Recombinant Drosophila melanogaster Putative odorant receptor 42a(Or42a)

https://www.keyrusbiopharma.com/web/image/product.template/124954/image_1920?unique=9fe42c5
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Drosophila melanogaster (Fruit fly) Uniprot NO.:Q9V9I2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDLRRWFPTLYTQSKDSPVRSRDATLYLLRCVFLMGVRKPPAKFFVAYVLWSFALNFCST FYQPIGFLTGYISHLSEFSPGEFLTSLQVAFNAWSCSTKVLIVWALVKRFDEANNLLDEM DRRITDPGERLQIHRAVSLSNRIFFFFMAVYMVYATNTFLSAIFIGRPPYQNYYPFLDWR SSTLHLALQAGLEYFAMAGACFQDVCVDCYPVNFVLVLRAHMSIFAERLRRLGTYPYESQ EQKYERLVQCIQDHKVILRFVDCLRPVISGTIFVQFLVVGLVLGFTLINIVLFANLGSAI AALSFMAAVLLETTPFCILCNYLTEDCYKLADALFQSNWIDEEKRYQKTLMYFLQKLQQP ITFMAMNVFPISVGTNISVTKFSFSVFTLVKQMNISEKLAKSEMEE Protein Names:Recommended name: Putative odorant receptor 42a Gene Names:Name:Or42a ORF Names:CG17250 Expression Region:1-406 Sequence Info:fµLl length protein

1.764,00 € 1764.0 EUR 1.764,00 €

1.764,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables