ELISA Recombinant Androgen-dependent TFPI-regulating protein(ADTRP)

Quantity: 10µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 15-20 working days Research Topic: Others Uniprot ID: Q96IZ2 Gene Names: ADTRP Organism: Homo sapiens () AA Sequence: MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK Expression Region: 1-230aa Sequence Info: FµLl Length Source: in vitro E.coli expression system Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged MW: 46.8 kDa Alternative Name(s): C6orf105 Relevance: RegµLates the expression and the cell-associated anticoagµLant activity of the inhibitor TFPI in endothelial cells Reference: "Next-generation sequencing to generate interactome datasets." Yu H., Tardivo L., Tam S., Weiner E., Gebreab F., Fan C., Svrzikapa N., Hirozane-Kishikawa T., Rietman E., Yang X., Sahalie J., Salehi-Ashtiani K., Hao T., Cusick M.E., Hill D.E., Roth F.P., Braun P., Vidal M. Nat. Methods 8:478-480(2011) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.