ELISA Recombinant Androgen-dependent TFPI-regulating protein(ADTRP)
Quantity: 10µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 15-20 working days
Research Topic: Others
Uniprot ID: Q96IZ2
Gene Names: ADTRP
Organism: Homo sapiens ()
AA Sequence: MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK
Expression Region: 1-230aa
Sequence Info: FµLl Length
Source: in vitro E.coli expression system
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW: 46.8 kDa
Alternative Name(s): C6orf105
Relevance: RegµLates the expression and the cell-associated anticoagµLant activity of the inhibitor TFPI in endothelial cells
Reference: "Next-generation sequencing to generate interactome datasets." Yu H., Tardivo L., Tam S., Weiner E., Gebreab F., Fan C., Svrzikapa N., Hirozane-Kishikawa T., Rietman E., Yang X., Sahalie J., Salehi-Ashtiani K., Hao T., Cusick M.E., Hill D.E., Roth F.P., Braun P., Vidal M. Nat. Methods 8:478-480(2011)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.