Se rendre au contenu

ELISA Recombinant Ashbya gossypii Cytochrome c oxidase subunit 2(COX2)

https://www.keyrusbiopharma.com/web/image/product.template/117622/image_1920?unique=7f7b80c
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii) Uniprot NO.:Q7YFV7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:DVPTPYNMYFQDSTTPHQEGILELHDNIMFYmLTVLGLVSWMMIIIIKDYKNNPITYKYI KHGQMIEIIWTILPAIILLMIAFPSFILLYLCDEVISPAMTIKVIGLQWYWKYEYSDFIN DNGETIEYESYMIPEELLEEGQLRmLDTDTSIVIPVDTHVRFIVTATDVIHDFAVPSLGI KIDTTPGRLSQVSTLIQREGIFYGQCSELCGAQHSAMPIKIETVKLPTFLTWLNEQ Protein Names:Recommended name: Cytochrome c oxidase subunit 2 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide II Gene Names:Name:COX2 Synonyms:CoxII Ordered Locus Names:AMI001W ORF Names:AgCOX2 Expression Region:13-248 Sequence Info:fµLl length protein

1.584,00 € 1584.0 EUR 1.584,00 €

1.584,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables