Se rendre au contenu

ELISA Recombinant 2-acylglycerol O-acyltransferase 3(MOGAT3)

https://www.keyrusbiopharma.com/web/image/product.template/129166/image_1920?unique=e52fe4f
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q86VF5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFTSLWPFSVFYL VWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMC TGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQ PQLGQAVVIMVGGAHEALYSVPGEHCLTLQKRKGFVRLALRHGASLVPVYSFGENDIFRL KAFATGSWQHWCQLTFKKLMGFSPCIFWGRGLFSATSWGLLPFAVPITTVVGRPIPVPQR LHPTEEEVNHYHALYMTALEQLFEEHKESCGVPASTCLTFI Protein Names:Recommended name: 2-acylglycerol O-acyltransferase 3 EC= 2.3.1.20 EC= 2.3.1.22 Alternative name(s): Acyl-CoA:monoacylglycerol acyltransferase 3 Short name= MGAT3 Diacylglycerol O-acyltransferase candidate 7 Short name= Gene Names:Name:MOGAT3 Synonyms:DC7, DGAT2L7 ORF Names:UNQ9383/PRO34208 Expression Region:1-341 Sequence Info:fµLl length protein

1.695,00 € 1695.0 EUR 1.695,00 €

1.695,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables