Se rendre au contenu

ELISA Recombinant Dictyostelium discoideum Latrophilin receptor-like protein A(lrlA)

https://www.keyrusbiopharma.com/web/image/product.template/124158/image_1920?unique=9fe42c5
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Dictyostelium discoideum (Slime mold) Uniprot NO.:Q54MC6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPSQLLNTVLSYLTDILLSLSIVGSFLTIFTFmLYPKLRSYPIKLIIYLCMSIVFSLFFF EISFRSSNSLFCIPAAILVHYFFLANFFWTFSVSFNFFQMIVKRNRDSEFYERYYHLISW GIPFIIIIFCAAFKKYVDRGGFCYLEDQYSVYFGFFMPGVIIVCSNICIYVFVAKEIYKT LRHTPTQKRQTVKEFRVYFSIFVSIGSSWIFGFIYMFSDSNSIIGYIFLILFSISTSLQG FFIFISYCLNYKVFAHYSRSFTQYGVSFFKRWENLDGETTQSGPTGTTDSSSTMTSTTTT TNVYSA Protein Names:Recommended name: Latrophilin receptor-like protein A Gene Names:Name:lrlA ORF Names:DDB_G0286037 Expression Region:1-306 Sequence Info:fµLl length protein

1.658,00 € 1658.0 EUR 1.658,00 €

1.658,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables