ELISA Recombinant Arabidopsis thaliana Probable steroid reductase DET2(DET2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:Q38944 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEEIADKTFFRYCLLTLIFAGPPTAVLLKFLQAPYGKHNRTGWGPTVSPPIAWFVMESPT LWLTLLLFPFGRHALNPKSLLLFSPYLIHYFHRTIIYPLRLFRSSFPAGKNGFPITIAAL AFTFNLLNGYIQARWVSHYKDDYEDGNWFWWRFVIGMVVFITGMYINITSDRTLVRLKKE NRGGYVIPRGGWFELVSCPNYFGEAIEWLGWAVMTWSWAGIGFFLYTCSNLFPRARASHK WYIAKFKEEYPKTRKAVIPFVY Protein Names:Recommended name: Probable steroid reductase DET2 EC= 1.3.99.- Gene Names:Name:DET2 Ordered Locus Names:At2g38050 ORF Names:T8P21.4 Expression Region:1-262 Sequence Info:fµLl length protein