ELISA Recombinant Delftia acidovorans Large-conductance mechanosensitive channel(mscL)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Delftia acidovorans (strain DSM 14801 / SPH-1) Uniprot NO.:A9BX57 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGMMQEFREFAVKGNVVDLAVGVIIGGAFGKIVDSVVNDLIMPVVGLVFGKLDFSNLFVV LGSVPPGTAMTLDALKKAGVPVFAYGNFITVAVNFIILAFIIFMMVKQINRLRREAPAAP APAPVTPEDIVLLREIRDSLKR Protein Names:Recommended name: Large-conductance mechanosensitive channel Gene Names:Name:mscL Ordered Locus Names:Daci_5504 Expression Region:1-142 Sequence Info:fµLl length protein