ELISA Recombinant Citrobacter koseri Rhomboid protease glpG(glpG)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) Uniprot NO.:A8AQX4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLMITSFANPRVAQAFVDYMATQGVILTIQQHHQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQSGHTGSGLHYRRFPFIATLRERAGPVTWLIMIACILVFVVMSIVGAQSVM VWLAWPFDPSLKFEFWRYFTHAFMHFSLMHILFNLLWWWYIGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYAWLRGERDPQSGIYLQRGLIAFALIWIVAG WFDVFGMSMANGAHIAGLAVGLAMAFADTVNARKRT Protein Names:Recommended name: Rhomboid protease glpG EC= 3.4.21.105 Alternative name(s): Intramembrane serine protease Gene Names:Name:glpG Ordered Locus Names:CKO_04842 Expression Region:1-276 Sequence Info:fµLl length protein