Se rendre au contenu

ELISA Recombinant Capsella bursa-pastoris Apocytochrome f(petA)

https://www.keyrusbiopharma.com/web/image/product.template/121542/image_1920?unique=7485b17
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Capsella bursa-pastoris (Shepherd's purse) (Thlaspi bursa-pastoris) Uniprot NO.:A4QKK5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:YPIFAQQNYENPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVKIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPNKKNILVIGPVPG QKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIIS KILRKEKGGYEITIVDASNGREVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF Protein Names:Recommended name: Apocytochrome f Gene Names:Name:petA Expression Region:36-320 Sequence Info:fµLl length protein

1.636,00 € 1636.0 EUR 1.636,00 €

1.636,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables