ELISA Recombinant Bacillus subtilis Choline transport system permease protein opuBD(opuBD)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bacillus subtilis (strain 168) Uniprot NO.:P39775 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNVLEQLMTYYAQNGSYVMDEFGRHFLMSAYGVLFAAVVGVPAGILIAHFRRLSAWVFAV TNVIQTIPALAmLAVLmLVMGLGANTVILSLFLYSLLPIIRNTYTGIISIEHAYLESGKA MGMTKFQVLRMVELPLALSVIMAGLRTALVIAIGITAIGTFVGAGGLGDMIVRGSNATNG TAIILAGAIPTAVMAVGADLLMAWLERALSPVKKKRTGAKHVQSAA Protein Names:Recommended name: Choline transport system permease protein opuBD Gene Names:Name:opuBD Synonyms:proZ Ordered Locus Names:BSU33700 Expression Region:1-226 Sequence Info:fµLl length protein