ELISA Recombinant Equine arteritis virus Glycoprotein 2b(GP2b)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Equine arteritis virus (strain Bucyrus) (EAV) Uniprot NO.:P28992 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AWWRGVHEVRVTDLFKDLQCDNLRAKDAFPSLGYALSIGQSRLSYmLQDWLLAAHRKEVM PSNIMPMPGLTPDCFDHLESSSYAPFINAYRQAILSQYPQELQLEAINCKLLAVVAPALY HNYHLANLTGPATWVVPTVGQLHYYASSSIFASSVEVLAAIILLFACIPLVTRVYISFTR LMSPSRRTSSGTLPRRKIL Protein Names:Recommended name: Glycoprotein 2b Short name= Protein GP2b Alternative name(s): GP(S) Gene Names:Name:GP2b ORF Names:2b Expression Region:29-227 Sequence Info:fµLl length protein