Se rendre au contenu

ELISA Recombinant V-type proton ATPase 16 kDa proteolipid subunit(ATP6V0C)

https://www.keyrusbiopharma.com/web/image/product.template/140615/image_1920?unique=bf930ac
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P27449 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVV MAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK Protein Names:Recommended name: V-type proton ATPase 16 kDa proteolipid subunit Short name= V-ATPase 16 kDa proteolipid subunit Alternative name(s): Vacuolar proton pump 16 kDa proteolipid subunit Gene Names:Name:ATP6V0C Synonyms:ATP6C, ATP6L, ATPL Expression Region:1-155 Sequence Info:FµLl length protein

1.499,00 € 1499.0 EUR 1.499,00 €

1.499,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables