ELISA Recombinant Arabidopsis thaliana Vacuolar iron transporter homolog 2.1(At3g25190)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:Q9LSF6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTSNVQLSETNSPRNQKTRPRAEKEEVDYMQRAQWLRAALLGANDGLVTVASLMMGVGSI KEDVKAmLLVGFAGLVAGACSMAIGEFVSVCTQRDIETAQMKRAIEHKTSLSAIDEQEEE EKKERLPNPGQAAIASALAFSVGAAMPLLGAVFIENHKVRMVVVAVVATIALVVFGVTGA VLGKTSVVKSSVRVVIGGWMAMALTFGLTKFIGSAAMQI Protein Names:Recommended name: Vacuolar iron transporter homolog 2.1 Alternative name(s): Protein NODµLIN-LIKE 21 Gene Names:Ordered Locus Names:At3g25190 ORF Names:MJL12.26 Expression Region:1-219 Sequence Info:fµLl length protein