Skip to Content

ELISA Recombinant Arabidopsis thaliana Inner membrane protein ALBINO3, chloroplastic(ALB3)

https://www.keyrusbiopharma.com/web/image/product.template/116727/image_1920?unique=7f7b80c
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:Q8LBP4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SLNEIPPFHGLDSSVDIGAIFTRAESLLYTIADAAVVGADSVVTTDSSAVQKSGGWFGFI SDAMELVLKILKDGLSAVHVPYAYGFAIILLTIIVKAATYPLTKQQVESTLAMQNLQPKI KAIQQRYAGNQERIQLETSRLYKQAGVNPLAGCLPTLATIPVWIGLYQALSNVANEGLFT EGFFWIPSLGGPTSIAARQSGSGISWLFPFVDGHPPLGWYDTVAYLVLPVLLIASQYVSM EIMKPPQTDDPAQKNTLLVFKFLPLMIGYFALSVPSGLSIYWLTNNVLSTAQQVYLRKLG GAKPNMDENASKIISAGRAKRSIAQPDDAGERFRQLKEQEKRSKKNKAVAKDTVELVEES QSESEEGSDDEEEEAREGALASSTTSKPLPEVGQRRSKRSKRKRTV Protein Names:Recommended name: Inner membrane protein ALBINO3, chloroplastic Gene Names:Name:ALB3 Ordered Locus Names:At2g28800 ORF Names:F8N16.9 Expression Region:57-462 Sequence Info:fµLl length protein

1,764.00 € 1764.0 EUR 1,764.00 €

1,764.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days