ELISA Recombinant Cellvibrio japonicus Lipoprotein signal peptidase(lspA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Cellvibrio japonicus (strain Ueda107) (Pseudomonas fluorescens subsp. cellµLosa) Uniprot NO.:B3PE13 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTKKVYHQYWFWYLAAFVVFLLDQGSKHWIEAAFDYNETKVFTSFFNFTLRYNPGAAFSF LADAGGWQRWFFTIVAVAASVLLIVWICRVASSKPREAFALSFILGGAVGNLYDRIIHGH VVDFIVVHYQDYYWPAFNLADAAISLGAMVLIADLFINPDKTSGEKPTNA Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II Gene Names:Name:lspA Ordered Locus Names:CJA_3216 Expression Region:1-170 Sequence Info:fµLl length protein