ELISA Recombinant Cathepsin S(CTSS)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Immunology Uniprot ID: P25774 Gene Names: CTSS Organism: Homo sapiens () AA Sequence: LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI Expression Region: 115-331aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 28 kDa Alternative Name(s): Relevance: Thiol protease. Key protease responsible for the roval of the invariant chain from MHC class II molecµLes. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N. Reference: MolecµLar cloning and expression of alveolar macrophage cathepsin S, an elastinolytic cysteine protease.Shi G.-P., Munger J.S., Meara J.P., Rich D.H., Chapman H.A.J. Biol. Chem. 267:7258-7262(1992) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.