ELISA Recombinant Haemophilus influenzae Probable intracellular septation protein A (CGSHiGG_07630)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Haemophilus influenzae (strain PittGG) Uniprot NO.:A5UHX7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKQLLDFIPLILFFITYKLGGVREAAIVLVVATILQIVILKWKYGMVEKQQKIMASAVVF FGLLTAYFNEIRYLQWKVTIINGLFAIVLLVAQFQFKTPLIKKLLGKELQLPEKAWNTLN LGWALFFIICmLVNIYISHNMSEEAWVDFKSFGIIGMTVIATIISGVYIYRYLPKDGSNS KDGEK Protein Names:Recommended name: Probable intracellµLar septation protein A Gene Names:Ordered Locus Names:CGSHiGG_07630 Expression Region:1-185 Sequence Info:fµLl length protein